PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10008629
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 315aa    MW: 34893.9 Da    PI: 5.9042
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10008629genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.84.9e-40101101101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkC+++C lapyfpa++p+ f+n+hklFG++n++k+l++l+ ++r++am+s+++eA++r   Pv G+vg i++lq++++q++ el++++
  Lus10008629  10 ACAACKYQRRKCSSECQLAPYFPANRPEMFRNAHKLFGVRNIVKILEKLDANQRHEAMHSIIWEANIRHLFPVDGCVGYIFRLQREIHQAQIELDAIH 107
                  7**********************************************************************************************999 PP

       DUF260  99 eel 101
                  ++l
  Lus10008629 108 AQL 110
                  875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.8129110IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-3710106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MTLKGGTSHA CAACKYQRRK CSSECQLAPY FPANRPEMFR NAHKLFGVRN IVKILEKLDA  60
NQRHEAMHSI IWEANIRHLF PVDGCVGYIF RLQREIHQAQ IELDAIHAQL HIYRQQHHHP  120
FSAADVGDNV DMVPSQLELG MAPPAGAGNA LALFSHDPDP QPFCPAGVVA DASLSPSPVT  180
PDQQHSYSMS SNNVGGLVGG YNNVGFLESK EPVGNSFWLR HNTTYVMHNN NNSTIPSTMA  240
LQSQLLGQQE VVQDYDEIHP FFDTIDDRQS YIDSKEAYDT SSEESLKDTT QSLEHVTENE  300
LKSAAACFSL TSVN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511502.11e-118PREDICTED: LOB domain-containing protein 27
TrEMBLB9R9271e-118B9R927_RICCO; LOB domain-containing protein, putative
STRINGPOPTR_0012s07390.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.16e-45LOB domain-containing protein 27